missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CDP/CUTL1 Polyclonal specifically detects CDP/CUTL1 in Mouse samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | CDP/CUTL1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | CCAAT displacement protein, CDP/Cux, CDPCCAAT displacement protein, COY1, CUT, cut (Drosophila)-like 1 (CCAAT displacement protein), cut-like 1, CCAAT displacement protein (Drosophila), cut-like homeobox 1, FLJ31745, golgi integral membrane protein 6, GOLIM6, homeobox protein cut-like 1, Homeobox protein cux-1, Nbla10317, p100, p110, p200, p75, protein CASP, putative protein product of Nbla10317 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse CDP/CUTL1 (NP_001278162.1). Peptide sequence PEEKEALKRAYQQKPYPSPKTIEELATQLNLKTSTVINWFHNYRSRIRRE |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?