missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDKN3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-58079
This item is not returnable.
View return policy
Description
CDKN3 Polyclonal specifically detects CDKN3 in Human samples. It is validated for Western Blot.
Specifications
| CDKN3 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CDI1KAP1, CDK2-associated dual specificity phosphatase, CDK2-associated dual-specificity phosphatase, Cdk-associated protein phosphatase, CIP2, cyclin-dependent kinase inhibitor 3, cyclin-dependent kinase interacting protein 2, Cyclin-dependent kinase interactor 1, Cyclin-dependent kinase-interacting protein 2, EC 3.1.3.16, EC 3.1.3.48, FLJ25787, KAPMGC70625, Kinase-associated phosphatase | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Equine: 92%; Bovine: 85%; Canine: 85%; Guinea pig: 85%; Mouse: 85%; Pig: 85%; Rat: 85%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q16667 | |
| CDKN3 | |
| Synthetic peptides corresponding to CDKN3(cyclin-dependent kinase inhibitor 3 (CDK2-associated dual specificity phosphatase)) The peptide sequence was selected from the C terminal of CDKN3. Peptide sequence CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μL | |
| Cell Cycle and Replication, Core ESC Like Genes, Protein Phosphatase, Stem Cell Markers | |
| 1033 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction