CDKN3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58459-25ul

Product Code. 18632527

Description

CDKN3 Polyclonal specifically detects CDKN3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CDKN3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: CDI1KAP1, CDK2-associated dual specificity phosphatase, CDK2-associated dual-specificity phosphatase, Cdk-associated protein phosphatase, CIP2, cyclin-dependent kinase inhibitor 3, cyclin-dependent kinase interacting protein 2, Cyclin-dependent kinase interactor 1, Cyclin-dependent kinase-interacting protein 2, EC 3.1.3.16, EC 3.1.3.48, FLJ25787, KAPMGC70625, Kinase-associated phosphatase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CDKN3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, Protein Phosphatase, Stem Cell Markers
• Gene ID (Entrez): 1033
• Target Species: Human
• Isotype: IgG

For Research Use Only