CDK8 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33454-100ul

Product Code. 30232961

Description

CDK8 Monoclonal antibody specifically detects CDK8 in Human,Mouse samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: CDK8
• Classification: Monoclonal
• Dilution: Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL
• Gene Alias: CDK8 protein kinase, Cell division protein kinase 8, cyclin-dependent kinase 8, EC 2.7.11, EC 2.7.11.22, EC 2.7.11.23, K35, Mediator complex subunit CDK8, Mediator of RNA polymerase II transcription subunit CDK8, MGC126074, MGC126075, Protein kinase K35
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 364-464 of human CDK8 (NP_001251.1).,, Sequence:, PDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 1024
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified