missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDK8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £460.00
Specifications
| Antigen | CDK8 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18228461
|
Novus Biologicals
NBP2-55134 |
100 μL |
£460.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18624098
|
Novus Biologicals
NBP2-55134-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CDK8 Polyclonal specifically detects CDK8 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| CDK8 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 1024 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| CDK8 protein kinase, Cell division protein kinase 8, cyclin-dependent kinase 8, EC 2.7.11, EC 2.7.11.22, EC 2.7.11.23, K35, Mediator complex subunit CDK8, Mediator of RNA polymerase II transcription subunit CDK8, MGC126074, MGC126075, Protein kinase K35 | |
| CDK8 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title