missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ CDK8 Antibody (2E6), Novus Biologicals™

Product Code. 18347977 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18347977 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18347977 Supplier Novus Biologicals™ Supplier No. H00001024M04

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

CDK8 Monoclonal antibody specifically detects CDK8 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Sandwich ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen CDK8
Applications ELISA, Western Blot, Sandwich ELISA
Classification Monoclonal
Clone 2E6
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_001251
Gene Alias CDK8 protein kinase, Cell division protein kinase 8, cyclin-dependent kinase 8, EC 2.7.11, EC 2.7.11.22, EC 2.7.11.23, K35, Mediator complex subunit CDK8, Mediator of RNA polymerase II transcription subunit CDK8, MGC126074, MGC126075, Protein kinase K35
Host Species Mouse
Immunogen CDK8 (NP_001251, 375 a.a. ∽ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 1024
Target Species Human, Mouse, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.