missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDK5RAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79651
This item is not returnable.
View return policy
Description
CDK5RAP1 Polyclonal specifically detects CDK5RAP1 in Rat samples. It is validated for Western Blot.
Specifications
| CDK5RAP1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| C20orf34, C42, CDK5 activator-binding protein C42, CDK5 regulatory subunit associated protein 1, CDK5 regulatory subunit-associated protein 1, CDK5RAP1.3, CDK5RAP1.4, CGI-05, chromosome 20 open reading frame 34, HSPC167 | |
| Rabbit | |
| 65 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Dog: 79%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_663773 | |
| CDK5RAP1 | |
| Synthetic peptide directed towards the C terminal of human Cdk5rap1The immunogen for this antibody is Cdk5rap1. Peptide sequence VIFPDAEVEDITDPGLKVRAQPGDYVLVKIISASSQTLKGHILCRTTMKD. | |
| Affinity purified | |
| RUO | |
| 51654 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction