missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDK5RAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | CDK5RAP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CDK5RAP1 Polyclonal specifically detects CDK5RAP1 in Human samples. It is validated for Western Blot.Specifications
| CDK5RAP1 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| 51654 | |
| Synthetic peptides corresponding to CDK5RAP1(CDK5 regulatory subunit associated protein 1) The peptide sequence was selected from the N terminal of CDK5RAP1. Peptide sequence MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C20orf34, C42, CDK5 activator-binding protein C42, CDK5 regulatory subunit associated protein 1, CDK5 regulatory subunit-associated protein 1, CDK5RAP1.3, CDK5RAP1.4, CGI-05, chromosome 20 open reading frame 34, HSPC167 | |
| CDK5RAP1 | |
| IgG | |
| This product is specific to Subunit or Isoform: -associated protein 1. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title