CDK2AP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-91776-25ul

Product Code. 18456861

Description

CDK2AP2 Polyclonal specifically detects CDK2AP2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CDK2AP2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: CDK2-associated protein 2tumor suppressor deleted in oral cancer related 1, cyclin-dependent kinase 2 associated protein 2, DOC1R, DOC-1Rcyclin-dependent kinase 2-associated protein 2, DOC-1-related protein, FLJ10636, p14, tumor suppressor deleted in oral cancer-related 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CDK2AP2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMG
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 10263
• Target Species: Human
• Isotype: IgG

For Research Use Only