missing translation for 'onlineSavingsMsg'
Learn More

CDK2AP2 Antibody, Novus Biologicals™

Product Code. 18368749 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18368749 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18368749 Supplier Novus Biologicals Supplier No. H00010263B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

CDK2AP2 Polyclonal antibody specifically detects CDK2AP2 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen CDK2AP2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation PBS (pH 7.4)
Gene Accession No. AAH02850
Gene Alias CDK2-associated protein 2tumor suppressor deleted in oral cancer related 1, cyclin-dependent kinase 2 associated protein 2, DOC1R, DOC-1Rcyclin-dependent kinase 2-associated protein 2, DOC-1-related protein, FLJ10636, p14, tumor suppressor deleted in oral cancer-related 1
Host Species Mouse
Immunogen CDK2AP2 (AAH02850, 1 a.a. - 126 a.a.) full-length human protein. MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 10263
Target Species Human, Mouse, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.