missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18300019

CDK2AP1 Antibody, Novus Biologicals™

Product Code. 18300019 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
50 μg
Unit Size:
50µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18300019 50 μg 50µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18300019 Supplier Novus Biologicals Supplier No. H00008099B02P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

CDK2AP1 Polyclonal antibody specifically detects CDK2AP1 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen CDK2AP1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS (pH 7.4)
Gene Accession No. AAH34717.1
Gene Alias CDK2-associated protein 1cyclin-dependent kinase 2-associated protein 1, CDKAP1, cyclin-dependent kinase 2 associated protein 1, Deleted in oral cancer 1, Deleted in oral cancer-1, doc-1, DOC1Putative oral cancer suppressor, DORC1, p12DOC-1, ST19
Host Species Mouse
Immunogen CDK2AP1 (AAH34717.1, 1 a.a. - 115 a.a.) full-length human protein. MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
Purification Method Protein G purified
Quantity 50 μg
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer
Primary or Secondary Primary
Gene ID (Entrez) 8099
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.