missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDK2AP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37963-20ul
This item is not returnable.
View return policy
Description
CDK2AP1 Polyclonal antibody specifically detects CDK2AP1 in Human samples. It is validated for ELISA,Western Blot
Specifications
| CDK2AP1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| CDK2-associated protein 1cyclin-dependent kinase 2-associated protein 1, CDKAP1, cyclin-dependent kinase 2 associated protein 1, Deleted in oral cancer 1, Deleted in oral cancer-1, doc-1, DOC1Putative oral cancer suppressor, DORC1, p12DOC-1, ST19 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human CDK2AP1 (NP_004633.1).,, Sequence:, MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS | |
| 20 μL | |
| Breast Cancer, Cancer | |
| 8099 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction