missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18322909

CDK20 Antibody (3E11), Novus Biologicals™

Código de producto. 18322909 Tienda Bio Techne Productos
Change view
Click to view available options
Quantity:
0.1 mg
Tamaño de la unidad:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantity unitSize
18322909 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18322909 Proveedor Novus Biologicals N.º de proveedor H00023552M13

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Mouse Monoclonal Antibody

CDK20 Monoclonal antibody specifically detects CDK20 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen CDK20
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 3E11
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH02655
Gene Alias CAK-kinase p42, CCRKEC 2.7.11.22, CDCHP42, CDK-activating kinase p42, cell cycle related kinase, Cell cycle-related kinase, Cell division protein kinase 20, cyclin-dependent kinase 20, Cyclin-dependent protein kinase H, Cyclin-kinase-activating kinase p42, EC 2.7.11, p42, PNQALRE
Host Species Mouse
Immunogen CCRK (AAH02655.1, 183 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIA
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 23552
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.