missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDK2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00 - £409.00
Specifications
| Antigen | CDK2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18246342
|
Novus Biologicals
NBP2-57327 |
100 μL |
£409.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18695577
|
Novus Biologicals
NBP2-57327-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CDK2 Polyclonal specifically detects CDK2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| CDK2 | |
| Polyclonal | |
| Rabbit | |
| Breast Cancer, Cancer, Cell Cycle and Replication, Ovarian Carcinoma Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 1017 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRIS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| cdc2-related protein kinase, cell devision kinase 2, Cell division protein kinase 2, cyclin-dependent kinase 2, EC 2.7.11, EC 2.7.11.22, p33 protein kinase, p33(CDK2) | |
| CDK2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title