CDC73/HRPT2 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33442-20ul

Product Code. 30232462

Description

CDC73/HRPT2 Monoclonal antibody specifically detects CDC73/HRPT2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: CDC73/HRPT2
• Classification: Monoclonal
• Dilution: Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL
• Gene Alias: C1orf28hyperparathyroidism 2 (with jaw tumor), cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S.cerevisiae), Cell division cycle protein 73 homolog, chromosome 1 open reading frame 28, HPTJT, HRPT2FLJ23316, Hyperparathyroidism 2 protein, HYX, parafibromin
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human CDC73/HRPT2 (NP_078805.3).,, Sequence:, GKEETEGFKIDTMGTYHGMTLKSVTEGASARKTQTPAAQPVPRPVSQARPPPNQKKGSRTPIIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRE
• Quantity: 20 μL
• Research Discipline: Cancer, Tumor Suppressors
• Gene ID (Entrez): 79577
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified