missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDC73/HRPT2 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33442-100ul
This item is not returnable.
View return policy
Description
CDC73/HRPT2 Monoclonal antibody specifically detects CDC73/HRPT2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| CDC73/HRPT2 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| C1orf28hyperparathyroidism 2 (with jaw tumor), cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S.cerevisiae), Cell division cycle protein 73 homolog, chromosome 1 open reading frame 28, HPTJT, HRPT2FLJ23316, Hyperparathyroidism 2 protein, HYX, parafibromin | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human CDC73/HRPT2 (NP_078805.3).,, Sequence:, GKEETEGFKIDTMGTYHGMTLKSVTEGASARKTQTPAAQPVPRPVSQARPPPNQKKGSRTPIIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRE | |
| 100 μL | |
| Cancer, Tumor Suppressors | |
| 79577 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction