Cdc6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68827-25ul

Product Code. 18695196

Description

Cdc6 Polyclonal antibody specifically detects Cdc6 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: Cdc6
• Classification: Polyclonal
• Dilution: Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
• Gene Alias: CDC18LHsCDC18, Cdc18-related protein, CDC6 (cell division cycle 6, S. cerevisiae) homolog, CDC6 cell division cycle 6 homolog, CDC6 cell division cycle 6 homolog (S. cerevisiae), CDC6-related protein, cell division control protein 6 homolog, cell division cycle 6 homolog (S. cerevisiae), cell division cycle 6 protein, HsCdc18, HsCDC6, p62(cdc6)
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSPSEPLIPKRVGLIHISQVISEVDGNRM
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 990
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified