CDC42EP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17693-100UL

Product Code. 18312765

Beskrivning

CDC42EP1 Polyclonal antibody specifically detects CDC42EP1 in Human samples. It is validated for Immunofluorescence

Specifikationer

• Antigen: CDC42EP1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Gene Alias: Binder of Rho GTPases 5, Borg5, BORG5cdc42 effector protein 1, CDC42 effector protein (Rho GTPase binding) 1, CEP155 kDa bone marrow stromal/endothelial cell protein, MSE55MGC15316, serum constituent protein, Serum protein MSE55
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV
• Quantity: 100 μg
• Research Discipline: Cell Biology, Cytoskeleton Markers, Signal Transduction
• Gene ID (Entrez): 11135
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified