missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CDC42EP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

CDC42EP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18348884 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18348884 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18348884 Supplier Novus Biologicals Supplier No. NBP310826100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CDC42EP1 Polyclonal specifically detects CDC42EP1 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CDC42EP1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias Binder of Rho GTPases 5, Borg5, BORG5cdc42 effector protein 1, CDC42 effector protein (Rho GTPase binding) 1, CEP155 kDa bone marrow stromal/endothelial cell protein, MSE55MGC15316, serum constituent protein, Serum protein MSE55
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CDC42EP1 (NP_689449.1). Peptide sequence TMHVGRGGDVFGDTSFLSNHGGSSGSTHRSPRSFLAKKLQLVRRVGAPPR
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11135
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.