missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDC40 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | CDC40 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18252435
|
Novus Biologicals
NBP2-58541 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18699526
|
Novus Biologicals
NBP2-58541-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CDC40 Polyclonal specifically detects CDC40 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| CDC40 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 51362 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Cell division cycle 40 homolog, cell division cycle 40 homolog (S. cerevisiae), cell division cycle 40 homolog (yeast), Ehb3, EH-binding protein 3, hPRP17, MGC102802, pre-mRNA splicing factor 17, pre-mRNA-processing factor 17, PRP17 homolog, PRP17EHB3PRPF17FLJ10564 | |
| CDC40 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title