missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDC2L2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | CDC2L2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18240375
|
Novus Biologicals
NBP2-57971 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18671098
|
Novus Biologicals
NBP2-57971-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CDC2L2 Polyclonal specifically detects CDC2L2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| CDC2L2 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cell Cycle and Replication, Cellular Markers, Protein Phosphatase, Signal Transduction | |
| CDK11-p110, CDK11-p58, cyclin-dependent kinase 11A, PITSLRE protein kinase beta | |
| CDK11A | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 728642 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title