missing translation for 'onlineSavingsMsg'
Learn More

CDC2/CDK1 Antibody (8F1), Novus Biologicals™

Product Code. 18322448 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18322448 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18322448 Supplier Novus Biologicals Supplier No. H00000983M04

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

CDC2/CDK1 Monoclonal antibody specifically detects CDC2/CDK1 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen CDC2/CDK1
Applications Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 8F1
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH14563
Gene Alias CDC28A, CDC2MGC111195, cell cycle controller CDC2, Cell division control protein 2 homolog, Cell division protein kinase 1, cyclin-dependent kinase 1, DKFZp686L20222, EC 2.7.11.22, EC 2.7.11.23, G1 to S and G2 to M, p34 protein kinase, P34CDC2
Host Species Mouse
Immunogen CDC2 (AAH14563, 211 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, Cell Cycle and Replication, Core ESC Like Genes, Mitotic Regulators, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 983
Target Species Human, Mouse, Rat
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a λ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.