CD77 Synthase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57614

Product Code. 18298344

Description

CD77 Synthase Polyclonal specifically detects CD77 Synthase in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CD77 Synthase
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: A14GALTalpha 1,4-galactosyltransferase (globotriaosylceramide synthase, P blood group), A4GALT1, alpha 1,4-galactosyltransferase, Alpha-1,4-galactosyltransferase, Alpha-1,4-N-acetylglucosaminyltransferase, alpha4Gal-T1, CD77 synthase, EC 2.4.1.228, Gb3 synthase, Gb3S, Globotriaosylceramide synthase, lactosylceramide 4-alpha-galactosyltransferase, P blood group (P one antigen), P(k), P(k) antigen synthase, P1, P1/Pk synthase, PK, UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 53947
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: A4GALT
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('EPKEKGQLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLD',)
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only