missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD68/SR-D1 Antibody (CL1346), Novus Biologicals™
Mouse Monoclonal Antibody
£292.00 - £435.00
Specifications
| Antigen | CD68/SR-D1 |
|---|---|
| Clone | CL1346 |
| Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Knockdown Validated |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18428841
|
Novus Biologicals
NBP2-34482-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18103243
|
Novus Biologicals
NBP2-34482 |
0.1 mL |
£435.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CD68/SR-D1 Monoclonal specifically detects CD68/SR-D1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| CD68/SR-D1 | |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Knockdown Validated | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| CD68 antigenmacrophage antigen CD68, CD68 molecule, DKFZp686M18236, GP110, macrosialin, SCARD1, scavenger receptor class D, member 1 | |
| CD68 | |
| IgG1 | |
| Protein A purified | |
| Specificity of human CD68/SR-D1 Antibody (CL1346) verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| CL1346 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| Mouse | |
| Cell Biology, Cytokine Research, Immunology, Microglia Markers | |
| P34810 | |
| 968 | |
| This CD68/SR-D1 Antibody (CL1346) was developed against a recombinant protein corresponding to amino acids: SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title