missing translation for 'onlineSavingsMsg'
Learn More

CD68/SR-D1 Antibody (CL1338), Novus Biologicals™

Product Code. 18483162 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18483162 25 μL 25µL
18172114 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18483162 Supplier Novus Biologicals Supplier No. NBP23448125ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

CD68/SR-D1 Monoclonal specifically detects CD68/SR-D1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CD68/SR-D1
Applications Immunohistochemistry
Classification Monoclonal
Clone CL1338
Conjugate Unconjugated
Dilution Immunohistochemistry 1:1000 - 1:2500
Gene Accession No. P34810
Gene Alias CD68 antigenmacrophage antigen CD68, CD68 molecule, DKFZp686M18236, GP110, macrosialin, SCARD1, scavenger receptor class D, member 1
Gene Symbols CD68
Host Species Mouse
Immunogen This CD68/SR-D1 Antibody (CL1338) was developed against a recombinant protein corresponding to amino acids: SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cell Biology, Cytokine Research, Immunology, Microglia Markers
Primary or Secondary Primary
Gene ID (Entrez) 968
Test Specificity Specificity of human CD68/SR-D1 Antibody (CL1338) verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.