CD63 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18457810	Novus Biologicals NBP1-82784-25ul	25 μL
18293547	Novus Biologicals NBP1-82784	0.1 mL

Description

CD63 Polyclonal specifically detects CD63 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CD63
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: CD63 antigen, CD63 antigen (melanoma 1 antigen), CD63 molecule, Granulophysin, LAMP-3, Lysosomal-associated membrane protein 3, ME491, melanoma 1 antigen, Melanoma-associated antigen ME491, melanoma-associated antigen MLA1, MLA1lysosome-associated membrane glycoprotein 3, Ocular melanoma-associated antigen, OMA81H, Tetraspanin-30, tspan-30, TSPAN30granulophysin
• Gene Symbols: CD63
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Autophagy, Cancer, Cardiovascular Biology, Cytokine Research, Immunology, Innate Immunity, Lysosome Markers, Metastasis
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 967
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIG
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only