missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CD40 Ligand/TNFSF5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

CD40 Ligand/TNFSF5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18354064 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18354064 25 μg 25µL
18084645 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18354064 Supplier Novus Biologicals Supplier No. NBP31698225UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CD40 Ligand/TNFSF5 Polyclonal antibody specifically detects CD40 Ligand/TNFSF5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen CD40 Ligand/TNFSF5
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias CD154, CD154 antigen, CD40 antigen ligand, CD40 ligand, CD40-L, CD40LIGM, gp39, hCD40L, HIGM1, T-B cell-activating molecule, T-BAM, T-cell antigen Gp39, TNF-related activation protein, TNFSF5IMD3, TRAPtumor necrosis factor (ligand) superfamily, member 5 (hyper-IgM syndrome), tumor necrosis factor (ligand) superfamily member 5, Tumor necrosis factor ligand superfamily member 5
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: EMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQL
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Adaptive Immunity, Apoptosis, Asthma, Biologically Active Proteins, Breast Cancer, Cancer, Cell Biology, Cellular Markers, Endothelial Cell Markers, Hematopoietic Stem Cell Markers, Hypoxia, Immunology, Innate Immunity, Mast Cell Markers, Mesenchymal Stem Cell Markers, Myeloid Cell Markers, Neuronal Cell Markers, Neuroscience, Stem Cell Markers, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 959
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.