missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD39L2/ENTPD6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | CD39L2/ENTPD6 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18254264
|
Novus Biologicals
NBP2-57315 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18677938
|
Novus Biologicals
NBP2-57315-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CD39L2/ENTPD6 Polyclonal specifically detects CD39L2/ENTPD6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CD39L2/ENTPD6 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 955 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHAEVTYRVSGQKAAASLHELCAARVSEVLQNRVHRTEEVKHVD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Unconjugated | |
| RUO | |
| Human | |
| CD39 antigen-like 2, CD39L2NTPDase-6, CD39-like 2, dJ738P15.3, DKFZp781G2277, DKFZp781K21102, EC 3.6.1.6, ectonucleoside triphosphate diphosphohydrolase 6, ectonucleoside triphosphate diphosphohydrolase 6 (putative function), ectonucleoside triphosphate diphosphohydrolase 6 (putative), FLJ36711, IL-6SAG, IL6ST2, interleukin 6 signal transducer-2, NTPDase 6 | |
| ENTPD6 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title