missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD300c Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£231.00 - £443.00
Specifications
| Antigen | CD300c/LMIR2 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18420461
|
Novus Biologicals
NBP1-84432-25ul |
25 μL |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18239477
|
Novus Biologicals
NBP1-84432 |
0.1 mL |
£443.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CD300c Polyclonal specifically detects CD300c in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CD300c/LMIR2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| CD300c antigenCMRF35 antigen, CD300c molecule, CLM-6, CMRF-35, CMRF35 leukocyte immunoglobulin-like receptor, CMRF-35A, CMRF35A leukocyte immunoglobulin-like receptor, CMRF35ACMRF35A1, CMRF35CMRF35-A1, CMRF35-like molecule 6, IgSF16, IGSF16CD300 antigen-like family member C, Immunoglobulin superfamily member 16, LIR | |
| CD300C | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Immunology | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10871 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title