missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CD300a/LMIR1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

CD300a/LMIR1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18357905 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18357905 25 μg 25µL
18322095 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18357905 Supplier Novus Biologicals Supplier No. NBP31781525UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CD300a/LMIR1 Polyclonal antibody specifically detects CD300a/LMIR1 in Human samples. It is validated for Western Blot, Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen CD300a/LMIR1
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias CD300a antigenCMRF35H9, CD300a molecule, CLM-8, CMRF-35H, CMRF35-H, CMRF35H leukocyte immunoglobulin-like receptor, CMRF35-H9, CMRF-35-H9CD300 antigen-like family member A, CMRF35HIRp60, CMRF35-like molecule 8, IgSF12, IGSF12NK inhibitory receptor, Immunoglobulin superfamily member 12, Inhibitory receptor protein 60, IRC1, IRC1/IRC2, IRC2, Irp60, leukocyte membrane antigen
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Mast Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 11314
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.