missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18369517

CD3 zeta Antibody, Novus Biologicals™

Product Code. 18369517 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18369517 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18369517 Supplier Novus Biologicals Supplier No. H00000919D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CD3 zeta Polyclonal antibody specifically detects CD3 zeta in Human, Mouse, Rat samples. It is validated for Western Blot, Proximity Ligation Assay
TRUSTED_SUSTAINABILITY

Specifications

Antigen CD3 zeta
Applications Western Blot, Proximity Ligation Assay
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_932170.1
Gene Alias CD247 antigen, CD247 antigen, zeta subunit, CD247 molecule, CD3H, CD3Q, CD3z antigen, zeta polypeptide (TiT3 complex), CD3ZT-cell receptor T3 zeta chain, T3Z, T-cell antigen receptor complex, zeta subunit of CD3, T-cell surface glycoprotein CD3 zeta chain, TCRZCD3-ZETA
Host Species Rabbit
Immunogen CD247 (NP_932170.1, 1 a.a. - 164 a.a.) full-length human protein. MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Adaptive Immunity, Cell Biology, Diabetes Research, Immunology, Innate Immunity, Protein Kinase, Signal Transduction, Tyrosine Kinases
Primary or Secondary Primary
Gene ID (Entrez) 919
Target Species Human, Mouse, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.