missing translation for 'onlineSavingsMsg'
Learn More

CD3 gamma Antibody (2A6), Novus Biologicals™

Product Code. 18328407 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18328407 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18328407 Supplier Novus Biologicals Supplier No. H00000917M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

CD3 gamma Monoclonal antibody specifically detects CD3 gamma in Human samples. It is validated for ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen CD3 gamma
Applications ELISA
Classification Monoclonal
Clone 2A6
Conjugate Unconjugated
Dilution ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_000064
Gene Alias CD3g antigen, CD3g antigen, gamma polypeptide (TiT3 complex), CD3g molecule, epsilon (CD3-TCR complex), CD3g molecule, gamma (CD3-TCR complex), CD3-GAMMA, FLJ17620, FLJ17664, FLJ79544, FLJ94613, MGC138597, T3G, T-cell antigen receptor complex, gamma subunit of T3, T-cell receptor T3 gamma chain, T-cell surface glycoprotein CD3 gamma chain
Host Species Mouse
Immunogen CD3G (NP_000064, 23 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Apoptosis, Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 917
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.