missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CD3 delta Rabbit anti-Human, Mouse, Rat, Clone: 2R1O10, Novus Biologicals™

CD3 delta Rabbit anti-Human, Mouse, Rat, Clone: 2R1O10, Novus Biologicals™

Product Code. 18395052
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18395052 100 μg 100µL
18374812 20 μg 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18395052 Supplier Bio-Techne Supplier No. NBP316881100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

CD3 delta Monoclonal antibody specifically detects CD3 delta in Human, Mouse, Rat samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen CD3 delta
Applications Western Blot, Flow Cytometry, Immunohistochemistry, Immunofluorescence
Classification Monoclonal
Clone 2R1O10
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Flow Cytometry 1:50 - 1:200, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias CD3 antigen, delta subunit, CD3d antigen, CD3d antigen, delta polypeptide (TiT3 complex), CD3d molecule, delta (CD3-TCR complex), CD3-DELTA, T3DOKT3, delta chain, T-cell receptor T3 delta chain, T-cell surface glycoprotein CD3 delta chain
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 72-171 of human CD3 delta (P04234). RCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Adaptive Immunity, Apoptosis, Diabetes Research, Immunology, Innate Immunity, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 915
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.