missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD24 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £460.00
Specifications
| Antigen | CD24 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18656718
|
Novus Biologicals
NBP2-68665-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18627828
|
Novus Biologicals
NBP2-68665 |
100 μg |
£460.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CD24 Polyclonal antibody specifically detects CD24 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| CD24 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| B Cell Development and Differentiation Markers, Cancer, Neuronal Cell Markers, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol | |
| 100133941 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CD 24, CD24 antigen, CD24 antigen (small cell lung carcinoma cluster 4 antigen), CD24 molecule, CD24Asignal transducer CD24, FLJ22950, FLJ43543, MGC75043, Small cell lung carcinoma cluster 4 antigen | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TTGTSSNSSQSTSNSGLAPNPTNATTKVAGGALQSTASLFVVSLSLLHLYS | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title