missing translation for 'onlineSavingsMsg'
Learn More

CD229/SLAMF3/Lymphocyte Antigen 9 Antibody, Novus Biologicals™

Product Code. 18415142 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Conditionnement:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantity unitSize
18415142 25 μL 25µL
18750544 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18415142 Fournisseur Novus Biologicals Code fournisseur NBP23077625ul

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Rabbit Polyclonal Antibody

CD229/SLAMF3/Lymphocyte Antigen 9 Polyclonal specifically detects CD229/SLAMF3/Lymphocyte Antigen 9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spécification

Antigen CD229/SLAMF3/Lymphocyte Antigen 9
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9HBG7
Gene Alias CD229, CD229 antigen, cell-surface molecule Ly-9, hly9, lymphocyte antigen 9Cell surface molecule Ly-9, mLY9, SLAMF3, T-lymphocyte surface antigen Ly-9
Gene Symbols LY9
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KRKGRCSVPAFCSSQAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRYE
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4063
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.