missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD21 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP2-38895
This item is not returnable.
View return policy
Description
CD21 Polyclonal specifically detects CD21 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| CD21 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| P20023 | |
| CR2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKS | |
| 0.1 mL | |
| Adaptive Immunity, Dendritic Cell Markers, Immunology | |
| 1380 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C3DRSLEB9, CD21, CD21 antigen, Complement C3d receptor, complement component (3d/Epstein Barr virus) receptor 2, complement receptor type 2, Cr2, EBV receptor, Epstein-Barr virus receptor | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction