missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CD1e Rabbit anti-Human, Polyclonal, Novus Biologicals™

CD1e Rabbit anti-Human, Polyclonal, Novus Biologicals™

Code produit 18332295 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantity:
100 μg
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantity unitSize
18332295 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18332295 Fournisseur Novus Biologicals Code fournisseur NBP310816100UL

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

CD1e Polyclonal specifically detects CD1e in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Spécification

Antigen CD1e
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias CD1e molecule, e polypeptide, FLJ17609, membrane-associated, thymocyte antigen CD1E
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CD1e (NP_001036048.1). Peptide sequence GRLQLVCHVSGFYPKPVWVMWMRGEQEQRGTQRGDVLPNADETWYLRATL
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 913
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.