missing translation for 'onlineSavingsMsg'
Learn More

CD1b Antibody (2E4), Novus Biologicals™

Product Code. 18362048 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18362048 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18362048 Supplier Novus Biologicals Supplier No. H00000910M06

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

CD1b Monoclonal antibody specifically detects CD1b in Human samples. It is validated for ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen CD1b
Applications ELISA, Sandwich ELISA
Classification Monoclonal
Clone 2E4
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_001755
Gene Alias CD1, CD1A, CD1b antigen, CD1B antigen, b polypeptide, CD1b molecule, cortical thymocyte antigen CD1B, differentiation antigen CD1-alpha-3, MGC125990, MGC125991, R1, T-cell surface glycoprotein CD1b
Host Species Mouse
Immunogen CD1B (NP_001755.1, 19 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKY
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Immunology
Primary or Secondary Primary
Gene ID (Entrez) 910
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.