missing translation for 'onlineSavingsMsg'
Learn More

CD11c Antibody, Novus Biologicals™

Product Code. 18411222 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18411222 25 μL 25µL
18396771 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18411222 Supplier Novus Biologicals Supplier No. NBP19121025ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

CD11c Polyclonal specifically detects CD11c in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CD11c
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias 95, 95 alpha chain, 95, alpha subunit, CD11 antigen-like family member C, CD11c, CD11c antigen, CD11Cleu M5, alpha subunit, integrin alpha-X, integrin, alpha X (antigen CD11C (p150), alpha polypeptide), integrin, alpha X (complement component 3 receptor 4 subunit), Leu M5, Leukocyte adhesion glycoprotein p150, Leukocyte adhesion receptor p150, leukocyte surface antigen p150, myeloid membrane antigen, alpha subunit, p150 95 integrin alpha chain, SLEB6
Gene Symbols ITGAX
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRV
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Dendritic Cell Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 3687
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.