missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CCZ1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

CCZ1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18377054 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18377054 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18377054 Supplier Novus Biologicals Supplier No. NBP310745100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CCZ1 Polyclonal specifically detects CCZ1 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CCZ1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias C7orf28A, C7orf28B, CCZ1 vacuolar protein trafficking and biogenesis associated homolog (S. cerevisiae), CCZ1 vacuolar protein trafficking and biogenesis associated homolog B (S. cerevisiae), CCZ1A, CGI-43, chromosome 7 open reading frame 28B, FLJ60592, H_DJ1163J12.2, H_NH0577018.2, MGC19819, vacuolar fusion protein CCZ1 homolog-like
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCZ1 (NP_932765). Peptide sequence PEENFWMVMVVRNPIIEKQSKDGKPVIEYQEEELLDKVYSSVLRQCYSMY
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51622
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.