missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18363828

CCR5 Antibody, Novus Biologicals™

Código de producto. 18363828 Tienda Bio Techne Productos
Change view
Click to view available options
Quantity:
0.1 mg
Tamaño de la unidad:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantity unitSize
18363828 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18363828 Proveedor Novus Biologicals N.º de proveedor H00001234D01P

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

CCR5 Polyclonal antibody specifically detects CCR5 in Human, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen CCR5
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. XP_001125981.1
Gene Alias C-C CKR-5, C-C motif chemokine receptor 5 A159A, CCCKR5, CC-CKR-5FLJ78003, CCR-5, CD195, CD195 antigen, chemokine (C-C motif) receptor 5, chemokine receptor CCR5, chemr13, CKR5, CKR-5, HIV-1 fusion coreceptor, IDDM22CMKBR5C-C chemokine receptor type 5
Host Species Rabbit
Immunogen CCR5 (XP_001125981.1, 1 a.a. - 352 a.a.) full-length human protein. MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cytokine Research, GPCR, Immunology, Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 1234
Target Species Human, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.