missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCNB3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | CCNB3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CCNB3 Polyclonal specifically detects CCNB3 in Human samples. It is validated for Western Blot.Specifications
| CCNB3 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| NP_149020 | |
| 85417 | |
| Synthetic peptide directed towards the C terminal of human CCNB3. Peptide sequence ISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKLE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| CYCB3, cyclin B3, G2/mitotic-specific cyclin-B3 | |
| CCNB3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title