missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCL3L1/LD78 beta Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-05563-20ul
This item is not returnable.
View return policy
Description
CCL3L1/LD78 beta Polyclonal antibody specifically detects CCL3L1/LD78 beta in Human samples. It is validated for Western Blot
Specifications
| CCL3L1/LD78 beta | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| C-C motif chemokine 3-like 1, CCL3L3, chemokine (C-C motif) ligand 3-like 1, D17S1718, G0/G1 switch regulatory protein 19-2, G0S19-2LD78, LD78BETA, LD78-beta(1-70), MGC104178, MGC12815, MGC182017, MIP1AP, PAT 464.2, SCYA3L, SCYA3L1464.2, small inducible cytokine A3-like 1, Small-inducible cytokine A3-like 1, Tonsillar lymphocyte LD78 beta protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 24-93 of human CCL3L1/LD78 beta (NP_066286.1). APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA | |
| 20 μg | |
| Cell Cycle and Replication, Cytokine Research | |
| 6349 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction