CCL3L1/LD78 beta Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-05563-100ul

Product Code. 18648327

Description

CCL3L1/LD78 beta Polyclonal antibody specifically detects CCL3L1/LD78 beta in Human samples. It is validated for Western Blot

Specifications

• Antigen: CCL3L1/LD78 beta
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: C-C motif chemokine 3-like 1, CCL3L3, chemokine (C-C motif) ligand 3-like 1, D17S1718, G0/G1 switch regulatory protein 19-2, G0S19-2LD78, LD78BETA, LD78-beta(1-70), MGC104178, MGC12815, MGC182017, MIP1AP, PAT 464.2, SCYA3L, SCYA3L1464.2, small inducible cytokine A3-like 1, Small-inducible cytokine A3-like 1, Tonsillar lymphocyte LD78 beta protein
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-93 of human CCL3L1/LD78 beta (NP_066286.1). APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
• Quantity: 100 μg
• Research Discipline: Cell Cycle and Replication, Cytokine Research
• Gene ID (Entrez): 6349
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified