missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18349399

CCL18/PARC Antibody (2C6), Novus Biologicals™

Product Code. 18349399 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18349399 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18349399 Supplier Novus Biologicals Supplier No. H00006362M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

CCL18/PARC Monoclonal antibody specifically detects CCL18/PARC in Human samples. It is validated for Western Blot, ELISA, Immunoprecipitation
TRUSTED_SUSTAINABILITY

Specifications

Antigen CCL18/PARC
Applications Western Blot, ELISA, Immunoprecipitation
Classification Monoclonal
Clone 2C6
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_002979
Gene Alias Alternative macrophage activation-associated CC chemokine 1, AMAC1CC chemokine ligand 18, AMAC-1Small-inducible cytokine A18, chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated), CKb7, DC-CK1CC chemokine PARC, DCCK1Macrophage inflammatory protein 4, Dendritic cell chemokine 1, MIP4, MIP-4C-C motif chemokine 18, PARCPulmonary and activation-regulated chemokine, SCYA18chemokine (C-C), dendritic, small inducible cytokine A18, small inducible cytokine subfamily A (Cys-Cys), member 18, pulmonary andactivation-regulated
Host Species Mouse
Immunogen CCL18 (NP_002979, 21 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 6362
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.