missing translation for 'onlineSavingsMsg'
Learn More

CCL14/HCC-1/HCC-3 Antibody (1F12), Novus Biologicals™

Product Code. 18365249 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18365249 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18365249 Supplier Novus Biologicals Supplier No. H00006358M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

CCL14/HCC-1/HCC-3 Monoclonal antibody specifically detects CCL14/HCC-1/HCC-3 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen CCL14/HCC-1/HCC-3
Applications Western Blot, ELISA
Classification Monoclonal
Clone 1F12
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH45165
Gene Alias C-C motif chemokine 14, chemokine (C-C motif) ligand 14, Chemokine CC-1/CC-3, chemokine CC-3, CKB1, FLJ16015, HCC-1, HCC-1(1-74), HCC-1/HCC-3, HCC-3, hemofiltrate CC chemokine 1, MCIF, member 14, NCC2CC-1, NCC-2CKb1, new CC chemokine 2, SCYA14CC-3, Small-inducible cytokine A14
Host Species Mouse
Immunogen CCL14 (AAH45165, 20 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 6358
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.