missing translation for 'onlineSavingsMsg'
Learn More

CCL1/I-309/TCA-3 Antibody (4E4), Novus Biologicals™

Product Code. 18391709 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18391709 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18391709 Supplier Novus Biologicals Supplier No. H00006346M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

CCL1/I-309/TCA-3 Monoclonal antibody specifically detects CCL1/I-309/TCA-3 in Human samples. It is validated for ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen CCL1/I-309/TCA-3
Applications ELISA, Sandwich ELISA
Classification Monoclonal
Clone 4E4
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_002972
Gene Alias C-C motif chemokine 1, chemokine (C-C motif) ligand 1, I-309, inflammatory cytokine I-309, P500, SCYA1Small-inducible cytokine A1, SISe, small inducible cytokine A1 (I-309, homologous to mouse Tca-3), T lymphocyte-secreted protein I-309, TCA3
Host Species Mouse
Immunogen CCL1 (NP_002972, 24 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Chemokines and Cytokines
Primary or Secondary Primary
Gene ID (Entrez) 6346
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.