missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CCL1/I-309/TCA-3 Monoclonal antibody specifically detects CCL1/I-309/TCA-3 in Human samples. It is validated for ELISA, ELISA
Specifications
Specifications
| Antigen | CCL1/I-309/TCA-3 |
| Applications | ELISA, Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 4E4 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_002972 |
| Gene Alias | C-C motif chemokine 1, chemokine (C-C motif) ligand 1, I-309, inflammatory cytokine I-309, P500, SCYA1Small-inducible cytokine A1, SISe, small inducible cytokine A1 (I-309, homologous to mouse Tca-3), T lymphocyte-secreted protein I-309, TCA3 |
| Host Species | Mouse |
| Immunogen | CCL1 (NP_002972, 24 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?