CCDC90A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-91586

Product Code. 18200239

Description

CCDC90A Polyclonal specifically detects CCDC90A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CCDC90A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C6orf79, coiled-coil domain containing 90A, coiled-coil domain-containing protein 90A, mitochondrial, FLJ20958
• Host Species: Rabbit
• Molecular Weight of Antigen: 40 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001026883
• Gene Symbols: CCDC90A
• Immunogen: Synthetic peptide directed towards the middle region of human CCDC90A. Peptide sequence ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 63933
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only