missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCDC9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£285.00 - £423.00
Specifications
| Antigen | CCDC9 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CCDC9 Polyclonal specifically detects CCDC9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| CCDC9 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 26093 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PTFGEFLSQHKAEASSRRRRKSSRPQAKAAPRAYSDHDDRWETKEGAASPAPETPQPTSPETSPKETPMQPPEIPAPA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| coiled-coil domain containing 9, coiled-coil domain-containing protein 9, DKFZP586M1019 | |
| CCDC9 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title