missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCDC87 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CCDC87 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CCDC87 Polyclonal specifically detects CCDC87 in Human samples. It is validated for Western Blot.Specifications
| CCDC87 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| coiled-coil domain containing 87, coiled-coil domain-containing protein 87, FLJ10786 | |
| CCDC87 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NVE4 | |
| 55231 | |
| Synthetic peptides corresponding to CCDC87(coiled-coil domain containing 87) The peptide sequence was selected from the N terminal of CCDC87. Peptide sequence MMEPPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSFPL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title